PDB entry 2bun

View 2bun on RCSB PDB site
Description: solution structure of the bluf domain of appa 5-125
Class: appa
Keywords: appa, fad, alpha-beta sandwich, bluf domain
Deposited on 2005-06-15, released 2005-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: appa
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53119 (0-120)
      • conflict (63)
      • conflict (72)
      • conflict (90)
    Domains in SCOPe 2.01: d2buna1
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bunA (A:)
    leadvtmtgsdlvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqw
    leghpaavaevmshiqrdrrhsnveilaeesiakrrfagwhmqlscseadmrslglaesr
    q