PDB entry 2bun

View 2bun on RCSB PDB site
Description: solution structure of the bluf domain of appa 5-125
Class: appa
Keywords: appa, fad, alpha-beta sandwich, bluf domain
Deposited on 2005-06-15, released 2005-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-20, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: appa
  Species: Rhodobacter sphaeroides
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q53119 (0-120)
    • conflict (63)
    • conflict (72)
    • conflict (90)
  Domains in SCOP 1.75: d2buna1
• Heterogens: FAD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bunA (A:)
  leadvtmtgsdlvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqw
  leghpaavaevmshiqrdrrhsnveilaeesiakrrfagwhmqlscseadmrslglaesr
  q