PDB entry 2bug

View 2bug on RCSB PDB site
Description: solution structure of the tpr domain from protein phosphatase 5 in complex with hsp90 derived peptide
Class: hydrolase
Keywords: tetratricopeptide domain, protein phosphatase, hsp90 binding, hydrolase, iron, manganese, metal-binding
Deposited on 2005-06-13, released 2006-03-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BUG
      • engineered mutation (75)
    • Uniprot P53041 (11-139)
    Domains in SCOPe 2.03: d2buga1
  • Chain 'B':
    Compound: hsp90
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bugA (A:)
msghhhhhhtdppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygn
rslaylrtecygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkp
hdkdakmkyqecnkivkqka

    Sequence, based on observed residues (ATOM records): (download) 
    >2bugA (A:)
tdppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrte
cygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmky
qecnkivkqka

  • Chain 'B':
    No sequence available.