PDB entry 2bug

View 2bug on RCSB PDB site
Description: solution structure of the tpr domain from protein phosphatase 5 in complex with hsp90 derived peptide
Class: hydrolase
Keywords: tetratricopeptide domain, protein phosphatase, hsp90 binding, hydrolase, iron, manganese, metal-binding
Deposited on 2005-06-13, released 2006-03-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-16, with a file datestamp of 2007-07-06.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine protein phosphatase 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BUG (Start-10)
      • engineered mutation (75)
    • Uniprot P53041 (11-139)
    Domains in SCOP 1.73: d2buga1
  • Chain 'B':
    Compound: hsp90 derived peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bugA (A:)
msghhhhhhtdppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygn
rslaylrtecygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkp
hdkdakmkyqecnkivkqka

    Sequence, based on observed residues (ATOM records): (download) 
    >2bugA (A:)
tdppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrte
cygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmky
qecnkivkqka

  • Chain 'B':
    No sequence available.