PDB entry 2buf

View 2buf on RCSB PDB site
Description: arginine feed-back inhibitable acetylglutamate kinase
Class: transferase
Keywords: acetyglutamate kinase, acetylglutamate, ADP, arginine biosynthesis, feed-back inhibition, hexamer, transferase, arginine inhibition, allosteric mechanism, feedback control, amino acid kinase family
Deposited on 2005-06-12, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.2491
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufa1
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufb_
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufc_
  • Chain 'D':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufd_
  • Chain 'E':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufe_
  • Chain 'F':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2buff_
  • Chain 'G':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufg_
  • Chain 'H':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufh_
  • Chain 'I':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufi_
  • Chain 'J':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufj_
  • Chain 'K':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufk_
  • Chain 'L':
    Compound: acetylglutamate kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bufl_
  • Heterogens: NLG, ADP, MG, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bufA (A:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufA (A:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqiidighvgevtgvnvgllnmlvkgdfipviapigvgs
    ngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiy
    ggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bufB (B:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufB (B:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqemtkpeiidighvgevtgvnvgllnmlvkgdfipvia
    pigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneli
    adgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bufC (C:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufC (C:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bufD (D:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufD (D:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtkpeiidighvgevtgvnvgllnmlvkgdfipviapi
    gvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliad
    gtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bufE (E:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufE (E:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtiidighvgevtgvnvgllnmlvkgdfipviapigvgsng
    esyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiygg
    mlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bufF (F:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufF (F:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqpeiidighvgevtgvnvgllnmlvkgdfipviapigv
    gsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgt
    iyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bufG (G:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufG (G:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bufH (H:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufH (H:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bufI (I:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufI (I:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtreiidighvgevtgvnvgllnmlvkgdfipviapigvgs
    ngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiy
    ggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bufJ (J:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufJ (J:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakklghvgevtgvnvgllnmlvkgdfipviapigvgsngesynina
    dlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiyggmlpkirc
    aleavqggvtsahiidgrvpnavlleiftdsgvgtlisnr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bufK (K:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufK (K:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshrvtdaatmdvvemvlggqvnkdivnlinrhggsaigl
    tgkdaelirakkltvgevtgvnvgllnmlvkgdfipviapigvgsngesyninadlvagk
    vaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiyggmlpkircaleavq
    ggvtsahiidgrvpnavlleiftdsgvgtlisnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bufL (L:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bufL (L:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqkpeiidighvgevtgvnvgllnmlvkgdfipviapig
    vgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadg
    tiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr