PDB entry 2bud

View 2bud on RCSB PDB site
Description: the solution structure of the chromo barrel domain from the males-absent on the first (mof) protein
Class: transferase
Keywords: mof,hat,acetyl-transfer,dosage compensation complex,dcc, royal family,chromodomain like,beta barrel,transferase acyltransferase, metal-binding
Deposited on 2005-06-09, released 2005-06-24
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-15, with a file datestamp of 2007-07-20.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: males-absent on the first protein
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2buda1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2budA (A:)
    gshmdplmqkidisenpdkiyfirredgtvhrgqvlqsrttenaaapdeyyvhyvglnrr
    ldgwvgrhrisdnaddlggitvlpapplapdq