PDB entry 2bud

View 2bud on RCSB PDB site
Description: the solution structure of the chromo barrel domain from the males-absent on the first (mof) protein
Class: transferase
Keywords: transferase, mof, hat, acetyl-transfer, dosage compensation complex, dcc, royal family, chromodomain like, beta barrel, transferase acyltransferase, metal-binding
Deposited on 2005-06-09, released 2005-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: males-absent on the first protein
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • PDB 2BUD (0-3)
  • Uniprot O02193 (4-91)
  Domains in SCOPe 2.08: d2buda1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2budA (A:)
  gshmdplmqkidisenpdkiyfirredgtvhrgqvlqsrttenaaapdeyyvhyvglnrr
  ldgwvgrhrisdnaddlggitvlpapplapdq