PDB entry 2bty

View 2bty on RCSB PDB site
Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
Class: transferase
Keywords: n-acetyl-l-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase, arginine biosynthesis, amino-acid biosynthesis, kinase
Deposited on 2005-06-08, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.242
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2btya1
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2btyb1
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2btyc1
  • Heterogens: K, ARG, NLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btyA (A:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btyB (B:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btyC (C:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg