PDB entry 2btx

View 2btx on RCSB PDB site
Description: solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, nmr, minimized average structure
Class: complex (toxin/peptide)
Keywords: complex (toxin/peptide), alpha-bungarotoxin, library peptide
Deposited on 1998-08-23, released 1999-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60615 (0-73)
  Domains in SCOPe 2.06: d2btxa_
• Chain 'B':
  Compound: library derived peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2BTX (0-12)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2btxA (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg
  

  
  
• Chain 'B':
  No sequence available.