PDB entry 2btw

View 2btw on RCSB PDB site
Description: crystal structure of alr0975
Class: transferase
Keywords: phytochelatin synthase, pcs, alr0975, nostoc, glutathione metabolism, cysteine protease, transferase
Deposited on 2005-06-07, released 2005-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alr0975 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2btwa1
  • Chain 'B':
    Compound: alr0975 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTW
      • conflict (130)
    • Uniprot Q8YY76
    Domains in SCOPe 2.08: d2btwb1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2btwA (A:)
    fcltlrrrytmghhhhhhhhhhssghiegrhmkleqtltlspnligfnsnegekllltsr
    sredffplsmqfvtqvnqaycgvasiimvlnslginapetaqyspyrvftqdnffsnekt
    kaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkqvaenlkqdgnfviv
    nylrkeigqergghisplaayneqtdrflimdvsrykyppvwvkttdlwkamntvdsvsq
    ktrgfvfvsktqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btwA (A:)
    lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
    taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
    iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
    pvwvkttdlwkamntvdsvsqktrgfvfvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2btwB (B:)
    fcltlrrrytmghhhhhhhhhhssghiegrhmkleqtltlspnligfnsnegekllltsr
    sredffplsmqfvtqvnqaycgvasiimvlnslginapetaqyspyrvftqdnffsnekt
    kaviapevvakqgmtldelgrliasygvkvkvnhasdtniedfrkqvaenlkqdgnfviv
    nylrkeigqergghisplaayneqtdrflimdvsrykyppvwvkttdlwkamntvdsvsq
    ktrgfvfvsktqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btwB (B:)
    lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
    taqyspyrvftqdnffsnektkaviapevvakqgmtldelgrliasygvkvkvnhasdtn
    iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
    pvwvkttdlwkamntvdsvsqktrgfvfvs