PDB entry 2btm

View 2btm on RCSB PDB site
Description: does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures?
Deposited on 1999-01-04, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.1756
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2btma_
  • Chain 'B':
    Domains in SCOP 1.55: d2btmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btmA (A:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btmB (B:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrh