PDB entry 2btm

View 2btm on RCSB PDB site
Description: does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures?
Class: isomerase
Keywords: thermophilic triose-phosphate, glycolysis, isomerase
Deposited on 1999-01-04, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (triosephosphate isomerase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00943 (0-250)
      • engineered (11-12)
      • engineered (229)
    Domains in SCOPe 2.07: d2btma_
  • Chain 'B':
    Compound: protein (triosephosphate isomerase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00943 (0-250)
      • engineered (11-12)
      • engineered (229)
    Domains in SCOPe 2.07: d2btmb_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2btmA (A:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btmA (A:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2btmB (B:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btmB (B:)
    rkpiiagnwkmngtlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgalvggaslepa
    sflqlveagrh