PDB entry 2btl

View 2btl on RCSB PDB site
Description: crystal structure of the n-terminal domain of ibv coronavirus nucleocapsid
Class: nucleocapsid protein
Keywords: nucleocapsid protein, phosphorylation, RNA-binding, viral nucleoprotein
Deposited on 2005-06-03, released 2005-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.23
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: infectious bronchitis virus nucleocapsid protein
    Species: AVIAN INFECTIOUS BRONCHITIS VIRUS [TaxId:11120]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTL (0-1)
      • engineered mutation (35)
      • engineered mutation (58)
      • engineered mutation (77)
      • engineered mutation (89)
    • Uniprot P69596 (2-133)
    Domains in SCOPe 2.08: d2btla1
  • Chain 'B':
    Compound: infectious bronchitis virus nucleocapsid protein
    Species: AVIAN INFECTIOUS BRONCHITIS VIRUS [TaxId:11120]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTL (0-1)
      • engineered mutation (35)
      • engineered mutation (58)
      • engineered mutation (77)
      • engineered mutation (89)
    • Uniprot P69596 (2-133)
    Domains in SCOPe 2.08: d2btlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btlA (A:)
    hmssgnaswfqaikakklntpppkfegsgvpdnenmkpsqqhgywrrqarfkpgkggrcp
    vpdawyfyytgtgpaadmnwgdtqdgivwmaakgadtksrsnqgtrdpdkfdqyplrfsd
    ggpdgnfrwdfipl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btlB (B:)
    hmssgnaswfqaikakklntpppkfegsgvpdnenmkpsqqhgywrrqarfkpgkggrcp
    vpdawyfyytgtgpaadmnwgdtqdgivwmaakgadtksrsnqgtrdpdkfdqyplrfsd
    ggpdgnfrwdfipl