PDB entry 2btj

View 2btj on RCSB PDB site
Description: Fluorescent Protein EosFP - red form
Class: fluorescent protein
Keywords: photo-induced protein cleavage, green-to-red conversion, fluorescent protein, luminescent protein
Deposited on 2005-06-01, released 2005-06-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1981
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTJ (0-1)
      • chromophore (61)
    • Uniprot Q5S6Z9 (2-219)
    Domains in SCOPe 2.03: d2btja_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTJ (0-1)
      • chromophore (61)
    • Uniprot Q5S6Z9 (2-219)
    Domains in SCOPe 2.03: d2btjb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTJ (0-1)
      • chromophore (61)
    • Uniprot Q5S6Z9 (2-219)
    Domains in SCOPe 2.03: d2btjc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTJ (0-1)
      • chromophore (61)
    • Uniprot Q5S6Z9 (2-219)
    Domains in SCOPe 2.03: d2btjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btjA (A:)
    ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhg
    vnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btjB (B:)
    ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhg
    vnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btjC (C:)
    ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhg
    vnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2btjD (D:)
    ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhg
    vnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakek
    gvklpgyhfvdhcieilshdkdynkvklyehavahsglpd