PDB entry 2bti

View 2bti on RCSB PDB site
Description: structure-function studies of the rmsa csra post-transcriptional global regulator protein family reveals a class of RNA-binding structure
Class: RNA binding protein
Keywords: rmsa, csra, RNA binding protein
Deposited on 2005-05-31, released 2006-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon storage regulator homolog
    Species: Yersinia enterocolitica [TaxId:630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTI (2-End)
    Domains in SCOPe 2.07: d2btia_
  • Chain 'B':
    Compound: carbon storage regulator homolog
    Species: Yersinia enterocolitica [TaxId:630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTI (2-End)
    Domains in SCOPe 2.07: d2btib_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2btiA (A:)
    gsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp
    tsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btiA (A:)
    smliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2btiB (B:)
    gsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp
    tsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btiB (B:)
    gsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeks