PDB entry 2bth

View 2bth on RCSB PDB site
Description: Peripheral-subunit binding domains from mesophilic, thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
Class: transferase
Keywords: acyltransferase, lipoyl, transferase
Deposited on 2005-05-31, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 2BTH
    • engineered mutation (42)
  • Uniprot P07016 (2-46)
  Domains in SCOPe 2.07: d2btha_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2bthA (A:)
  gsqnndalspairrllaehnldasaikgtgvggrltredvekwlaka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bthA (A:)
  qnndalspairrllaehnldasaikgtgvggrltredvekwlaka