PDB entry 2btg

View 2btg on RCSB PDB site
Description: peripheral-subunit binding domains from mesophilic,thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
Class: transferase
Keywords: acyltransferase, lipoyl, transferase
Deposited on 2005-05-31, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BTG
      • engineered mutation (42)
    • Uniprot P07016 (2-46)
    Domains in SCOPe 2.07: d2btga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2btgA (A:)
    gsqnndalspairrllaehnldasaikgtgvggrltredvekwlaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btgA (A:)
    qnndalspairrllaehnldasaikgtgvggrltredvekwlaka