PDB entry 2btg

View 2btg on RCSB PDB site
Description: peripheral-subunit binding domains from mesophilic,thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
Class: transferase
Keywords: acyltransferase, lipoyl, transferase
Deposited on 2005-05-31, released 2006-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 2BTG
    • engineered mutation (42)
  • Uniprot P07016 (2-46)
  Domains in SCOPe 2.08: d2btga_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2btgA (A:)
  gsqnndalspairrllaehnldasaikgtgvggrltredvekwlaka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2btgA (A:)
  qnndalspairrllaehnldasaikgtgvggrltredvekwlaka