PDB entry 2btc

View 2btc on RCSB PDB site
Description: bovine trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor II)
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, trypsin inhibitor, hydrolase/hydrolase inhibitor complex
Deposited on 1998-12-11, released 2000-01-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2btce_
  • Chain 'I':
    Compound: protein (trypsin inhibitor)
    Species: Cucurbita pepo [TaxId:3663]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2btci_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2btcE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2btcI (I:)
rvcpkilmeckkdsdclaeciclehgycg