PDB entry 2btc

View 2btc on RCSB PDB site
Description: bovine trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor ii)
Deposited on 1998-12-11, released 2000-01-19
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-19, with a file datestamp of 2000-01-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d2btce_
  • Chain 'I':
    Domains in SCOP 1.55: d2btci_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2btcE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2btcI (I:)
rvcpkilmeckkdsdclaeciclehgycg