PDB entry 2bt6

View 2bt6 on RCSB PDB site
Description: ru(bpy)2(mbpy)-modified bovine adrenodoxin
Class: electron transport
Keywords: ruthenium(II) bipyridyl complex, intramolecular electron transfer, electron transport, metal-binding
Deposited on 2005-05-26, released 2006-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adrenodoxin 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00257 (4-107)
      • expression tag (3)
    Domains in SCOPe 2.07: d2bt6a2, d2bt6a3
  • Chain 'B':
    Compound: Adrenodoxin 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bt6b_
  • Heterogens: FES, RUA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bt6A (A:)
    gssgdkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
    qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt6A (A:)
    gdkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhi
    fekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bt6B (B:)
    gssgdkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
    qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt6B (B:)
    dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
    ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp