PDB entry 2bt3

View 2bt3 on RCSB PDB site
Description: agao in complex with ruthenium-c4-wire at 1.73 angstroms
Class: oxidoreductase
Keywords: 3d-structure, amine oxidase, arthrobacter globiformis, copper, copper containing, oxidoreductase, tpq, quinone, ruthenium diimine wires, competitive inhibition
Deposited on 2005-05-26, released 2005-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.15484
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bt3a1, d2bt3a2, d2bt3a3
  • Heterogens: CU, NA, SO4, R4A, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bt3A (A:)
    pstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrv
    fihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkal
    aarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvv
    skevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewek
    wsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgey
    lvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsgi
    nytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisql
    apglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltrese
    avreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlw
    vtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpim
    pvdtvgfklrpegffdrspvldvpanpsqsgshchgsnwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt3A (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan