PDB entry 2bt2

View 2bt2 on RCSB PDB site
Description: structure of the regulator of g-protein signaling 16
Class: signaling protein
Keywords: gtpase activating protein, signal transduction inhibitor, signaling protein
Deposited on 2005-05-25, released 2005-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15492 (23-End)
      • expression tag (16-22)
      • variant (107)
      • conflict (107)
    Domains in SCOPe 2.05: d2bt2a_
  • Chain 'B':
    Compound: Regulator of G-protein signaling 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15492 (23-End)
      • expression tag (16-22)
      • variant (107)
      • conflict (107)
    Domains in SCOPe 2.05: d2bt2b_
  • Chain 'C':
    Compound: Regulator of G-protein signaling 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15492 (23-End)
      • expression tag (15-22)
      • variant (107)
      • conflict (107)
    Domains in SCOPe 2.05: d2bt2c_
  • Chain 'D':
    Compound: Regulator of G-protein signaling 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15492 (23-End)
      • expression tag (17-22)
      • variant (107)
      • conflict (107)
    Domains in SCOPe 2.05: d2bt2d_
  • Chain 'E':
    Compound: Regulator of G-protein signaling 16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15492 (23-End)
      • expression tag (15-22)
      • variant (107)
      • conflict (107)
    Domains in SCOPe 2.05: d2bt2e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bt2A (A:)
    mhhhhhhssgvdlgtenlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefse
    enlefwlaceefkkirsatklasrahqifeeficseapkevnidhetreltrmnlqtata
    tcfdaaqgktrtlmekdsyprflkspayrdlaaqasaasat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt2A (A:)
    nlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkir
    satklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmek
    dsyprflkspayrdlaaqasaas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bt2B (B:)
    mhhhhhhssgvdlgtenlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefse
    enlefwlaceefkkirsatklasrahqifeeficseapkevnidhetreltrmnlqtata
    tcfdaaqgktrtlmekdsyprflkspayrdlaaqasaasat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt2B (B:)
    nlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkir
    satklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmek
    dsyprflkspayrdlaaqasaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bt2C (C:)
    mhhhhhhssgvdlgtenlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefse
    enlefwlaceefkkirsatklasrahqifeeficseapkevnidhetreltrmnlqtata
    tcfdaaqgktrtlmekdsyprflkspayrdlaaqasaasat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt2C (C:)
    enlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkki
    rsatklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlme
    kdsyprflkspayrdlaaqasa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bt2D (D:)
    mhhhhhhssgvdlgtenlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefse
    enlefwlaceefkkirsatklasrahqifeeficseapkevnidhetreltrmnlqtata
    tcfdaaqgktrtlmekdsyprflkspayrdlaaqasaasat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt2D (D:)
    lyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirs
    atklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekd
    syprflkspayrdlaaqasaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bt2E (E:)
    mhhhhhhssgvdlgtenlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefse
    enlefwlaceefkkirsatklasrahqifeeficseapkevnidhetreltrmnlqtata
    tcfdaaqgktrtlmekdsyprflkspayrdlaaqasaasat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bt2E (E:)
    enlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkki
    rsatklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlme
    kdsyprflkspayrdlaaqasaa