PDB entry 2bsy

View 2bsy on RCSB PDB site
Description: epstein barr virus dutpase
Class: hydrolase
Keywords: dutpase, monomer, hydrolase, nucleotide metabolism, structural proteomics in europe, spine, structural genomics
Deposited on 2005-05-24, released 2005-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.15
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: HUMAN HERPESVIRUS 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bsya1, d2bsya2
  • Heterogens: UMP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bsyA (A:)
    meacphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglml
    wgstsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpqmeedk
    gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
    vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
    frwasctfeevpslamgdsglsealegrqgrgfgssgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsyA (A:)
    cphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglmlwgs
    tsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpqmgpinhpq
    ypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgilvkpcrwr
    rggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprslfrwasct
    feevpslam