PDB entry 2bsw

View 2bsw on RCSB PDB site
Description: Crystal structure of a glyphosate-N-acetyltransferase obtained by DNA shuffling.
Class: transferase
Keywords: transferase, gnat superfamily, glyphosate n-acetyltransferase
Deposited on 2005-05-24, released 2005-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.6300000000000001 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyphosate n-acetyltransferase
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BSW (Start-145)
    Domains in SCOPe 2.08: d2bswa1
  • Heterogens: CAO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bswA (A:)
    mievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqae
    hselqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykk
    lgfseqgevfdtppvgphilmykrit
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bswA (A:)
    ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
    selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
    gfseqgevfdtppvgphilmykrit