PDB entry 2bsn

View 2bsn on RCSB PDB site
Description: structure analysis of cobe, an essential protein of cobalamin biosynthesis from pseudomonas aeruginosa
Class: biosynthetic protein
Keywords: cobalamin, vitamin b12, pseudomonas aeruginosa, cobe, biosynthetic protein
Deposited on 2005-05-23, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-30, with a file datestamp of 2008-12-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein involved in cobalamin biosynthesis
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed):
    • PDB 2BSN (0-2)
    • Uniprot Q9HZQ0 (3-End)
    Domains in SCOPe 2.07: d2bsna_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bsnA (A:)
    gshmplpipslliagigcrrgcsaehlrallertlgehgrslaeldalasidgkrdepgl
    rqlatllerpvhflapavlhdyeprllspsavalretgcssvaeaaalalaerlgggrad
    llgakrsddrasialarllterelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsnA (A:)
    gshmplpipslliagigcrrgcsaehlrallertlgehgrslaeldalasidgkrdepgl
    rqlatllerpvhflapavlhdyeprllspsavalretgcssvaeaaalalaerlgggrad
    llgakrsddrasialarllter