PDB entry 2bsk

View 2bsk on RCSB PDB site
Description: crystal structure of the tim9 tim10 hexameric complex
Class: protein transport
Keywords: protein transport, tim9, tim10, mitochondrial protein import, tim complex
Deposited on 2005-05-23, released 2006-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.2679
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial import inner membrane translocase subunit tim9 a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bska1
  • Chain 'B':
    Compound: mitochondrial import inner membrane translocase subunit tim10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bskb1
  • Chain 'C':
    Compound: mitochondrial import inner membrane translocase subunit tim9 a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bskc1
  • Chain 'D':
    Compound: mitochondrial import inner membrane translocase subunit tim10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bskd1
  • Chain 'E':
    Compound: mitochondrial import inner membrane translocase subunit tim9 a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: mitochondrial import inner membrane translocase subunit tim10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bskf1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bskA (A:)
    maaqipesdqikqfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmt
    qrismrfqeyhiqqnealaakagllgqpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bskA (A:)
    qfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmtqrismrfqeyhi
    qqnealaakagll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bskB (B:)
    mdplraqqlaaelevemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyld
    ihermgkkltelsmqdeelmkrvqqssgpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bskB (B:)
    levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel
    smqde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bskC (C:)
    maaqipesdqikqfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmt
    qrismrfqeyhiqqnealaakagllgqpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bskC (C:)
    dqikqfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmtqrismrfq
    eyhiqqnealaakagllgq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bskD (D:)
    mdplraqqlaaelevemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyld
    ihermgkkltelsmqdeelmkrvqqssgpa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bskF (F:)
    mdplraqqlaaelevemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyld
    ihermgkkltelsmqdeelmkrvqqssgpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bskF (F:)
    aaelevemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkl
    tels