PDB entry 2bsd

View 2bsd on RCSB PDB site
Description: structure of lactococcal bacteriophage p2 receptor binding protein
Class: receptor
Keywords: lactococcus lactis, phage, llama vhh, receptor binding protein, receptor
Deposited on 2005-05-20, released 2005-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22097
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor binding protein
    Species: Lactococcus lactis phage p2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bsda1, d2bsda2, d2bsda3
  • Chain 'B':
    Compound: receptor binding protein
    Species: Lactococcus lactis phage p2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bsdb1, d2bsdb2, d2bsdb3
  • Chain 'C':
    Compound: receptor binding protein
    Species: Lactococcus lactis phage p2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bsdc1, d2bsdc2, d2bsdc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bsdA (A:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsdA (A:)
    tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
    netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
    tgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrf
    fgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidk
    tpiatrgngsyfik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bsdB (B:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsdB (B:)
    tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
    netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
    tgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrf
    fgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidk
    tpiatrgngsyfik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bsdC (C:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsdC (C:)
    tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
    netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
    tgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrf
    fgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidk
    tpiatrgngsyfik