PDB entry 2bsb

View 2bsb on RCSB PDB site
Description: e. coli f17e-g lectin domain complex with n-acetylglucosamine
Class: lectin
Keywords: bacterial adhesion, protein-sugar complex, fimbriae, lectin
Deposited on 2005-05-20, released 2006-05-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f17g adhesin subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RH92 (0-175)
      • conflict (32)
      • conflict (46)
    Domains in SCOPe 2.01: d2bsba_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bsbA (A:)
    avsfigstendvgpsqgsysrthamdnlpfvydtgynigyqnanvwhisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bsbA (A:)
    avsfigstendvgpsqgsyslpfvydtgynigyqnanvwhisggfcvgldgkvdlpvvgs
    ldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqglsvhvrpv
    ilysvqktsigsirmrpyngssagsvqttvnfslnpftlndt