PDB entry 2bs8

View 2bs8 on RCSB PDB site
Description: Crystal structure of F17b-G in complex with N-acetyl-D-glucosamine
Class: sugar-binding protein
Keywords: lectin, fimbriae, protein-sugar complex, sugar-binding protein
Deposited on 2005-05-18, released 2005-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.3317
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adhesin
  Species: ESCHERICHIA COLI B [TaxId:37762]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47200 (0-175)
  Domains in SCOPe 2.05: d2bs8a_
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bs8A (A:)
  vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
  dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
  svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt