PDB entry 2bs7

View 2bs7 on RCSB PDB site
Description: crystal structure of f17b-g in complex with chitobiose
Class: lectin
Keywords: bacterial adhesin, bacterial attachment, pathogenesis, immunoglobulin fold adhesin, lectin, fimbriae, protein-sugar complex
Deposited on 2005-05-18, released 2006-05-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: f17bg lectin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bs71_
  • Heterogens: CBS, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bs71 (1:)
    vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwsvgnylstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt