PDB entry 2bs7

View 2bs7 on RCSB PDB site
Description: Crystal structure of F17b-G in complex with chitobiose
Class: lectin
Keywords: bacterial adhesin, bacterial attachment, pathogenesis, immunoglobulin fold adhesin, lectin, fimbriae, protein-sugar complex
Deposited on 2005-05-18, released 2006-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain '1':
  Compound: f17bg lectin
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47200 (112-175)
  Domains in SCOPe 2.08: d2bs71_
• Heterogens: HOH

PDB Chain Sequences:

• Chain '1':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bs71 (1:)
  vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
  dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwsvgnylstqgl
  svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt