PDB entry 2bs3

View 2bs3 on RCSB PDB site
Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
Class: oxidoreductase
Keywords: oxidoreductase, 2fe-2s, 3d-structure, 3fe-4s, 4fe-4s, citric acid cycle, dihaem cytochrome b, electron transport, fad, flavoprotein, fumarate reductase, heme, ion-sulphur protein, iron, iron- sulfur, metal-binding, respiratory chain, succinate dehydrogenase, transmembrane, tricarboxylic acid cycle
Deposited on 2005-05-14, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinol-fumarate reductase flavoprotein subunit a
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bs3a1, d2bs3a2, d2bs3a3
  • Chain 'B':
    Compound: quinol-fumarate reductase iron-sulfur subunit b
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bs3b1, d2bs3b2
  • Chain 'C':
    Compound: quinol-fumarate reductase diheme cytochrome b subunit c
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • conflict see remark 9 (179)
    Domains in SCOPe 2.07: d2bs3c1
  • Chain 'D':
    Compound: quinol-fumarate reductase flavoprotein subunit a
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bs3d1, d2bs3d2, d2bs3d3
  • Chain 'E':
    Compound: quinol-fumarate reductase iron-sulfur subunit b
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bs3e1, d2bs3e2
  • Chain 'F':
    Compound: quinol-fumarate reductase diheme cytochrome b subunit c
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • conflict see remark 9 (179)
    Domains in SCOPe 2.07: d2bs3f_
  • Heterogens: FAD, CIT, NA, FES, F3S, SF4, HEM, LMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bs3A (A:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bs3B (B:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bs3C (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs3C (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bs3D (D:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bs3E (E:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bs3F (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs3F (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthh