PDB entry 2bs2

View 2bs2 on RCSB PDB site
Description: quinol:fumarate reductase from wolinella succinogenes
Class: oxidoreductase
Keywords: oxidoreductase, respiratory chain,, citric acid cycle, iron-sulphur protein
Deposited on 2005-05-14, released 2006-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.229
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinol-fumarate reductase flavoprotein subunit a
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17412 (0-655)
    • PDB 2BS2
    Domains in SCOPe 2.07: d2bs2a1, d2bs2a2, d2bs2a3
  • Chain 'B':
    Compound: quinol-fumarate reductase iron-sulfur subunit b
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17596 (0-238)
    • PDB 2BS2 (239-End)
    Domains in SCOPe 2.07: d2bs2b1, d2bs2b2
  • Chain 'C':
    Compound: quinol-fumarate reductase diheme cytochrome b subunit c
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-253)
    • PDB 2BS2 (254-End)
    Domains in SCOPe 2.07: d2bs2c_
  • Chain 'D':
    Compound: quinol-fumarate reductase flavoprotein subunit a
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17412 (0-655)
    • PDB 2BS2
    Domains in SCOPe 2.07: d2bs2d1, d2bs2d2, d2bs2d3
  • Chain 'E':
    Compound: quinol-fumarate reductase iron-sulfur subunit b
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17596 (0-238)
    • PDB 2BS2 (239-End)
    Domains in SCOPe 2.07: d2bs2e1, d2bs2e2
  • Chain 'F':
    Compound: quinol-fumarate reductase diheme cytochrome b subunit c
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-253)
    • PDB 2BS2 (254-End)
    Domains in SCOPe 2.07: d2bs2f_
  • Heterogens: FAD, FUM, NA, FES, F3S, SF4, HEM, LMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bs2A (A:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdkqrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2A (A:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bs2B (B:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvnm
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2B (B:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvnm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bs2C (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2C (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bs2D (D:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdkqrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2D (D:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bs2E (E:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvnm
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2E (E:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvnm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bs2F (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs2F (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthe