PDB entry 2brv

View 2brv on RCSB PDB site
Description: Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate.
Class: lyase
Keywords: (alfa5/alfa5) barrel, cell wall, lyase, peptidoglycan-anchor
Deposited on 2005-05-11, released 2006-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • see remark 999 (5)
      • see remark 999 (28)
      • see remark 999 (328)
      • see remark 999 (373)
      • see remark 999 (536)
      • see remark 999 (568)
      • see remark 999 (622)
    • PDB 2BRV
    Domains in SCOPe 2.07: d2brvx1, d2brvx2, d2brvx3
  • Heterogens: MLA

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2brvX (X:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    ygnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brvX (X:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssilwekfsnyktsan
    ltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgnwwdyeig
    tprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnlvdmgrvk
    viagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygnvlidgls
    qllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranseghvaave
    vlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsllsdagvas
    vprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfyly
    ngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdf
    tnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeas
    lteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkeven
    efltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvydakqgvwgi
    vkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkkle