PDB entry 2brs

View 2brs on RCSB PDB site
Description: embp heparin complex
Class: lectin
Keywords: antibiotic, embp, eosinophil, eosinophil granule protein, glycoprotein, heparin-binding, immune response, lectin, proteoglycan, signal, heparin
Deposited on 2005-05-11, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.247
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil-granule major basic protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2brsa_
  • Chain 'B':
    Compound: eosinophil-granule major basic protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2brsb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2brsA (A:)
    tcryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritg
    sgrcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brsA (A:)
    ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
    rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2brsB (B:)
    tcryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritg
    sgrcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brsB (B:)
    ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
    rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy