PDB entry 2brr

View 2brr on RCSB PDB site
Description: complex of the neisserial pora p1.4 epitope peptide and two fab-fragments (antibody mn20b9.34)
Class: antibody/antigen complex
Keywords: fab fragment, anti-pora antibody, p1.4 antibody, antigen, porin, transmembrane, antibody/antigen complex
Deposited on 2005-05-11, released 2005-07-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-20, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: mn20b9.34 anti-p1.4 antibody, fab heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (Start-224)
    Domains in SCOP 1.75: d2brrh1
  • Chain 'L':
    Compound: mn20b9.34 anti-p1.4 antibody, fab light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2brrl1, d2brrl2
  • Chain 'P':
    Compound: class 1 outer membrane protein variable region 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: mn20b9.34 anti-p1.4 antibody, fab light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2brrx1, d2brrx2
  • Chain 'Y':
    Compound: mn20b9.34 anti-p1.4 antibody, fab heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (0-224)
    Domains in SCOP 1.75: d2brry1
  • Heterogens: SO4, NH2, ACY, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2brrH (H:)
    avqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brrH (H:)
    vqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgeptya
    ddfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvtv
    ssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlq
    sdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2brrL (L:)
    envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2brrX (X:)
    envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brrX (X:)
    nvltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvpa
    rfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2brrY (Y:)
    avqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg