PDB entry 2brj

View 2brj on RCSB PDB site
Description: x-ray structure of the allene oxide cyclase from arabidopsis thaliana
Class: isomerase
Keywords: cyclase, jasmonate synthesis, allene oxide cyclase, beta barrel, isomerase, transit peptide
Deposited on 2005-05-06, released 2006-08-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arabidopsis thaliana genomic DNA, chromosome 3,
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRJ
    • Uniprot Q9LS02 (Start-187)
    Domains in SCOPe 2.01: d2brja1
  • Chain 'B':
    Compound: arabidopsis thaliana genomic DNA, chromosome 3,
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRJ
    • Uniprot Q9LS02 (Start-187)
    Domains in SCOPe 2.01: d2brjb_
  • Chain 'C':
    Compound: arabidopsis thaliana genomic DNA, chromosome 3,
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRJ
    • Uniprot Q9LS02 (Start-187)
    Domains in SCOPe 2.01: d2brjc_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2brjA (A:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brjA (A:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2brjB (B:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brjB (B:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2brjC (C:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brjC (C:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn