PDB entry 2brf

View 2brf on RCSB PDB site
Description: crystal structure of the fha domain of human polynucleotide kinase 3' phosphatase
Class: hydrolase/transferase
Keywords: hydrolase/transferase, fha, forkhead-associated, pnkp, pnk, polynucleotide kinase 3' phosphatase, DNA repair, ber, ssbr, dsbr, xrcc1, xrcc4 hydrolase, transferase, bifunctional
Deposited on 2005-05-04, released 2005-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.152
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional polynucleotide phosphatase/kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96T60
      • conflict (17)
    Domains in SCOPe 2.07: d2brfa1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2brfA (A:)
    mgeveapgrlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetr
    tvavkqlgvnpsttgtqelkpglegslgvgdtlylvnglhpltlrweetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brfA (A:)
    grlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetrtvavkql
    gvnpsttgqelkpglegslgvgdtlylvnglhpltlrwee