PDB entry 2br4

View 2br4 on RCSB PDB site
Description: cmci-d160 mg-sam
Class: porin
Keywords: cephamycin biosynthesis, porin
Deposited on 2005-05-01, released 2006-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4a_
  • Chain 'B':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4b_
  • Chain 'C':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4c_
  • Chain 'D':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4d_
  • Chain 'E':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4e_
  • Chain 'F':
    Compound: cephalosporin hydroxylase cmci
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85726
      • engineered mutation (199)
    Domains in SCOPe 2.07: d2br4f_
  • Heterogens: MG, SAM, PEG, P4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2br4A (A:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4A (A:)
    dysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglr
    mlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrc
    qipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegdy
    fiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2br4B (B:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4B (B:)
    dysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglr
    mlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrc
    qipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegdy
    fiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2br4C (C:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4C (C:)
    ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
    rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
    cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
    yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2br4D (D:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4D (D:)
    ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
    rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
    cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
    yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2br4E (E:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4E (E:)
    ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
    rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
    cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
    yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2br4F (F:)
    mndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrg
    lrmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdls
    rcqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleeg
    dyfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br4F (F:)
    ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
    rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
    cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
    yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrv