PDB entry 2br2

View 2br2 on RCSB PDB site
Description: RNAse ph core of the archaeal exosome
Class: hydrolase
Keywords: exosome, RNAse ph, phosphorolytic, exoribonuclease, RNA degradation, archaeal, hydrolase
Deposited on 2005-04-30, released 2005-06-06
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2a1, d2br2a2
  • Chain 'B':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2b1, d2br2b2
  • Chain 'C':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2c1, d2br2c2
  • Chain 'D':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2d1, d2br2d2
  • Chain 'E':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2e1, d2br2e2
  • Chain 'F':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2f1, d2br2f2
  • Chain 'G':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2g1, d2br2g2
  • Chain 'H':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2h1, d2br2h2
  • Chain 'I':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2i1, d2br2i2
  • Chain 'J':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2j1, d2br2j2
  • Chain 'K':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2k1, d2br2k2
  • Chain 'L':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2l1, d2br2l2
  • Chain 'M':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2m1, d2br2m2
  • Chain 'N':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2n1, d2br2n2
  • Chain 'O':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2o1, d2br2o2
  • Chain 'P':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2p1, d2br2p2
  • Chain 'Q':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2q1, d2br2q2
  • Chain 'R':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2r1, d2br2r2
  • Chain 'S':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2s1, d2br2s2
  • Chain 'T':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2t1, d2br2t2
  • Chain 'U':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2u1, d2br2u2
  • Chain 'V':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2v1, d2br2v2
  • Chain 'W':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2w1, d2br2w2
  • Chain 'X':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2br2x1, d2br2x2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2br2A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2br2B (B:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2br2C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2br2D (D:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2D (D:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2br2E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2br2F (F:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2F (F:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2br2G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2br2H (H:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2H (H:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2br2I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2br2J (J:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2J (J:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2br2K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2br2L (L:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2L (L:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2br2M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2br2N (N:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2N (N:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2br2O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2br2P (P:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2br2Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2br2R (R:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2R (R:)
    mlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpke
    mhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprt
    aidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedm
    wgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvef
    keegv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2br2S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2br2T (T:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2T (T:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2br2U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2br2V (V:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2V (V:)
    lqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkem
    hprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprta
    idvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmw
    geadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefk
    eegv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2br2W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2br2X (X:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br2X (X:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v