PDB entry 2br1

View 2br1 on RCSB PDB site
Description: structure-based design of novel chk1 inhibitors: insights into hydrogen bonding and protein-ligand affinity
Class: transferase
Keywords: drug design, furanopyrimidine, molecular recognition, oncology, pyrrolopyrimidine, x-ray crystallography, kinase, transferase
Deposited on 2005-04-29, released 2005-05-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2br1a1
  • Heterogens: SO4, PFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2br1A (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br1A (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
    envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
    githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
    haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
    ilvenpsaritipdikkdrwynkplkkgakrp