PDB entry 2bqq

View 2bqq on RCSB PDB site
Description: X-ray Structure of the N-terminal Domain of Human Doublecortin
Class: transferase
Keywords: dcx domain, ubiquitin-like fold, microtubule associated, signaling protein, transferase
Deposited on 2005-04-27, released 2006-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BQQ
      • engineered mutation (96-97)
    • Uniprot O43602
    Domains in SCOPe 2.07: d2bqqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bqqA (A:)
gamdpefalsnekkakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninl
pqgvryiytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv

    Sequence, based on observed residues (ATOM records): (download) 
    >2bqqA (A:)
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnws