PDB entry 2bqp

View 2bqp on RCSB PDB site
Description: the structure of the pea lectin-d-glucopyranose complex
Class: sugar binding protein
Keywords: pea lectin, d-glucopyranose complex
Deposited on 1998-12-08, released 1998-12-16
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-29, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pea lectin)
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bqpa_
  • Chain 'B':
    Compound: protein (pea lectin)
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bqpb_
  • Heterogens: GLC, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bqpA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nnsleeevtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bqpA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bqpB (B:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nnsleeevtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bqpB (B:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels