PDB entry 2bqp

View 2bqp on RCSB PDB site
Description: the structure of the pea lectin-d-glucopyranose complex
Deposited on 1998-12-08, released 1998-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d2bqpa_
  • Chain 'B':
    Domains in SCOP 1.67: d2bqpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bqpA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nnsleeevtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bqpA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bqpB (B:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nnsleeevtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bqpB (B:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    nvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels