PDB entry 2bqk

View 2bqk on RCSB PDB site
Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOP 1.71 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d2bqk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bqk_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcga