PDB entry 2bqf

View 2bqf on RCSB PDB site
Description:
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOP 1.63 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2bqf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bqf_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdnvadavaaakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv