PDB entry 2bq3

View 2bq3 on RCSB PDB site
Description: DNA adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine
Class: transferase
Keywords: p2 DNA polymerase IV, 1n2-ethenoguanine adduct, translesion DNA polymerase, nucleotidyltransferase, transferase
Deposited on 2005-04-27, released 2005-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bq3a1, d2bq3a2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*cp*a)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*tp*gnep*gp*ap*ap*tp*cp*cp *tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bq3A (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq3A (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.