PDB entry 2bq1

View 2bq1 on RCSB PDB site
Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium
Class: oxidoreductase
Keywords: r1, r2, r1e, r2f, iron, class 1b, holocomplex, allosteric regulation, ribonucleotide reductase, ATP-binding, metal-binding, oxidoreductase, DNA replication, radical transfer, allosteric enzyme, asymmetric complex, nucleotide-binding
Deposited on 2005-04-26, released 2006-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.265
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ribonucleoside-diphosphate reductase 2 alpha subunit
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bq1e1, d2bq1e2
  • Chain 'F':
    Compound: ribonucleoside-diphosphate reductase 2 alpha subunit
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bq1f1, d2bq1f2
  • Chain 'I':
    Compound: ribonucleoside-diphosphate reductase 2 beta subunit
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bq1i1
  • Chain 'J':
    Compound: ribonucleoside-diphosphate reductase 2 beta subunit
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bq1j1
  • Heterogens: DGT, MG, FE

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bq1E (E:)
    matttpervmqetmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqh
    erlgtlvregyyddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgk
    rylehfedrvtmvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfl
    lriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmled
    afsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipditfrla
    kenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfe
    sgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgsl
    niahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylar
    egiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqd
    dwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhats
    sihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqg
    lsltlffpdtattrdinkaqiyawrkgikslyyirlrqlalegteiegcvscal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq1E (E:)
    etmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregy
    yddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvt
    mvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfllriednmesig
    ravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmledafsyanqgaga
    vylhahhpdilrfldtkriktlslgvvipditfrlakenaqmalfspydiqrrygkpfgd
    iaiserydeliadphvrktyinardffqtlaeiqfesgypyimfedtvnranpiagrinm
    snlcseilqvnsasryddnldythighdiscnlgslniahvmdspdigrtvetairglta
    vsdmshirsvpsiaagnaashaiglgqmnlhgylaregiaygspealdftnlyfytitwh
    avhtsmrlarergktfagfaqsryasgdyftqylqddwqpktakvralfarsgitlptre
    mwlklrddvmrygiynqnlqavpptgsisyinhatssihpivakieirkegktgrvyypa
    pfmtnenldmyqdaydigpekiidtyaeatrhvdqglsltlffpdtattrdinkaqiyaw
    rkgikslyyirlrqla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bq1F (F:)
    matttpervmqetmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqh
    erlgtlvregyyddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgk
    rylehfedrvtmvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfl
    lriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmled
    afsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipditfrla
    kenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfe
    sgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgsl
    niahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylar
    egiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqd
    dwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhats
    sihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqg
    lsltlffpdtattrdinkaqiyawrkgikslyyirlrqlalegteiegcvscal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq1F (F:)
    qetmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvreg
    yyddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrv
    tmvaltlaqgdetlatqltdemlsgrfqpatptflncgkqqrgelvscfllriednmesi
    gravnsalqlskrgggvafllsnlreagapikrienqssgvipvmkmledafsyanqgag
    avylhahhpdilrfldtkrenadekiriktlslgvvipditfrlakenaqmalfspydiq
    rrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfesgypyimfedtvnra
    npiagrinmsnlcseilqvnsasryddnldythighdiscnlgslniahvmdspdigrtv
    etairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylaregiaygspealdftn
    lyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqddwqpktakvralfar
    sgitlptremwlklrddvmrygiynqnlqavpptgsisyinhatssihpivakieirkeg
    ktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqglsltlffpdtattrd
    inkaqiyawrkgikslyyirlrqla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bq1I (I:)
    mklsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvf
    tgltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevda
    ayawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneiryteal
    yaetgwvndvkaflcynankalmnlgyealfppemadvnpailaalspnadenhdffsgs
    gssyvmgktvetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq1I (I:)
    isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
    ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
    eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
    rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
    wvndvkaflcynankalmnlgyealfppemadvnpailaalsptvetededwnf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bq1J (J:)
    mklsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvf
    tgltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevda
    ayawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneiryteal
    yaetgwvndvkaflcynankalmnlgyealfppemadvnpailaalspnadenhdffsgs
    gssyvmgktvetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq1J (J:)
    isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
    ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
    eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
    rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
    wvndvkaflcynankalmnlgyealfppemadvnpailaal