PDB entry 2bpn

View 2bpn on RCSB PDB site
Description: solution structure of desulfovibrio vulgaris (hildenborough) ferricytochrome c3, nmr, 20 structures
Class: electron transport
Keywords: electron transport, hemeprotein, cytochrome c3, redox cooperativity, redox-bohr cooperativity, transduction, paramagnetic
Deposited on 2005-04-21, released 2006-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: DESULFOVIBRIO VULGARIS [TaxId:882]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00131 (0-106)
  Domains in SCOPe 2.08: d2bpna_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bpnA (A:)
  apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
  sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche