PDB entry 2bpn

View 2bpn on RCSB PDB site
Description: solution structure of desulfovibrio vulgaris (hildenborough) ferricytochrome c3, nmr, 20 structures
Class: electron transport
Keywords: electron transport, hemeprotein, cytochrome c3, redox cooperativity, redox-bohr cooperativity, transduction, paramagnetic
Deposited on 2005-04-21, released 2006-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bpna_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bpnA (A:)
    apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche