PDB entry 2bph

View 2bph on RCSB PDB site
Description: structure of murine dectin-1
Class: receptor
Keywords: receptor, dectin-1, beta-glucan, fungal recognition, c-type lectin-like domain, ctld, carbohydrate
Deposited on 2005-04-19, released 2006-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BPH (133-End)
    • Uniprot Q6QLQ4 (Start-132)
    Domains in SCOPe 2.07: d2bpha1, d2bpha2
  • Chain 'B':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BPH (133-End)
    • Uniprot Q6QLQ4 (Start-132)
    Domains in SCOPe 2.07: d2bphb1, d2bphb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bphA (A:)
    mggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqts
    shrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqi
    cntssysicekelkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bphA (A:)
    qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
    afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
    ysicekelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bphB (B:)
    mggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqts
    shrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqi
    cntssysicekelkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bphB (B:)
    qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
    afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
    ysicekelk